PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK40095.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Trihelix
Protein Properties Length: 112aa    MW: 12531.8 Da    PI: 4.4375
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK40095.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix43.58.1e-144291150
    trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqC 50
                rW++ e+laL+++r+em++++r++ lk+plWee+++  +++ +e++ k+ 
  KFK40095.1 42 RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEIARSSSRKEIEKEEKEL 91
                8*************************************999999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.8E-741104No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MSVNSSGPLD SSGGVIGSSD EEEKDMKMEE TGDRGGGGGG NRWPRPETLA LLRIRSEMDK  60
AFRDSTLKAP LWEEIARSSS RKEIEKEEKE LERIVYEVDK RVNGEAREET TE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300884.12e-24hypothetical protein CARUB_v10019974mg, partial
RefseqXP_010533325.12e-24PREDICTED: trihelix transcription factor GT-2-like, partial
SwissprotQ391174e-24TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A087HD932e-73A0A087HD93_ARAAL; Uncharacterized protein
STRINGAT1G76890.21e-21(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-19Trihelix family protein